This app will generate a predicted structure for the input amino acid sequence using the selected engine.

Readme
ICDS-Roar-OOD Protein Structure Prediction

Overview

An Open OnDemand Batch Connect app that provides a web-based interface for running protein structure prediction jobs using AlphaFold 2 and AlphaFold 3 on the ICDS Roar cluster. The app simplifies the process of submitting and monitoring AlphaFold jobs by providing a user-friendly interface and automated job management.

This app uses the Batch Connect basic template with Slurm. It executes a two-phase workflow: a CPU phase for MSA generation and a GPU phase for structure prediction, with the GPU job submitted as a dependency of the CPU job.

  • Upstream project: AlphaFold by DeepMind
  • Batch Connect template: basic
  • Scheduler: Slurm
  • Container runtime: Singularity

How it looks

Launch form

Model selection, partition & working directory (left) JSON input & terms of service (right)
Form left Form right

Progress after job submission

Progress left Progress right

Supporting Materials

Conference Materials

  • GOOD25 Conference Talk Abstract
  • GOOD25 Conference Presentation

News Articles

  • Leveraging AlphaFold in Graduate Research
  • OSC News: Inaugural GOOD Conference Draws Strong Attendance from 10 Countries

> Presented as a talk at the Global Open On Demand Conference 2025, Harvard University
> Date: March 19, 2025, 4:00 PM – 4:25 PM (25 min)
> Title: AlphaFold accessibility: an optimized open-source OOD app for Protein Structure Prediction
> Speakers: Vinay Saji Mathew [Pennsylvania State University] , William Lai [Cornell], Matt Hansen [Pennsylvania State University] > > Track: Application Track [featuring AI OnDemand]
> Location: Tsai Auditorium (CGIS S010)

Features

Multiple Prediction Engines

  • AlphaFold 2:

    • Supports AlphaFold v2.3.2 for protein structure prediction
    • Handles both monomer and multimer predictions
    • Uses full database configuration for maximum accuracy
    • Automated MSA generation and template search
  • AlphaFold 3 (New!):

    • Latest version of AlphaFold with improved accuracy
    • Supports protein-protein, protein-DNA/RNA, and protein-ligand complexes
    • Enhanced diffusion-based structure prediction
    • Requires acceptance of Google's terms of service

Job Management

  • Two-phase execution:
    • CPU phase for MSA/templates
    • GPU phase for prediction (set as a dependency)
  • Real-time job status monitoring
  • Detailed progress tracking
  • Automatic error handling and recovery

User Interface

  • Flexible Input Formats:
  • GPU allocation selection
  • Working directory customization
  • Real-time progress visualization
  • Direct access to output files

Output Files

  • AlphaFold 2:

    • PDB structure files (ranked by confidence)
    • Multiple Sequence Alignment (MSA) files
    • Detailed prediction metrics and confidence scores
    • Comprehensive log files
  • AlphaFold 3:

    • CIF structure files
    • Ranking scores for multiple predictions
    • Detailed model outputs and metrics
    • Complete execution logs

Prerequisites

Open OnDemand

  • Slurm scheduler
  • Has been tested to work with OOD v3 & v4

Database Setup

Both AlphaFold versions require genetic databases that must be set up before using the app:

  • AlphaFold 2: Download using script from AlphaFold 2 repository
  • AlphaFold 3: Additional databases required. Setup instructions available here

Singularity Containers

The app uses Singularity containers for execution:

  • AlphaFold 2: Download from Sylabs
  • AlphaFold 3: Requires official container from Google (subject to terms of use). Weights needed for running AlphaFold 3 have to be requested from Google here

Installation

  1. Clone this repository into your Open OnDemand apps directory
  2. Configure paths in template/alphafold_env.sh
  3. Ensure all required databases are properly set up
  4. Verify GPU compute capabilities.

Configure for your site

Edit form.yml.erb and update these values for your cluster:

Attribute ICDS Default Change to
cluster rc Your cluster name
auto_accounts (dynamic) GPU account selection for your site
auto_queues (dynamic) Queue/partition for your site
working_directory /scratch/ Default scratch path on your site

In before.sh.erb, the app sources alphafold_env.sh to set environment variables for database paths, container paths, and working directories. You must configure this file for your site.

Configuration

form.yml attributes

Attribute Widget Description Default
session_type select Prediction engine (AlphaFold 2 or AlphaFold 3) AlphaFold 2
auto_accounts select GPU account for job submission (dynamic)
auto_queues select Queue/partition for job submission (dynamic)
working_directory path_selector Output directory (scratch space recommended) /scratch/
protein_sequence text_area Input sequence (FASTA for AF2, JSON for AF3) (empty)
agree_terms check_box Accept Google's Terms of Service (AF3 only) unchecked
bc_email_on_started check_box Email notification on job start/completion unchecked

Usage

  1. Access the Open OnDemand dashboard
  2. Navigate to "Interactive Apps"
  3. Select "Protein Structure Prediction"
  4. Choose prediction engine (AlphaFold 2 or 3)
  5. Fill out the form:
    • For AlphaFold 2: Enter protein sequence in FASTA format
    • For AlphaFold 3: Provide input in JSON format
    • Select GPU allocation
    • Choose working directory
  6. Accept terms of service (required for AlphaFold 3)
  7. Submit the job

Input Format Examples

AlphaFold 2 (FASTA)

The app accepts protein sequences in FASTA format.

Example:

>sequence_name
MVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKA
ENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS

AlphaFold 3 (JSON)

{
"name": "example_complex",
"sequences": [
{
"protein": {
"id": "protein_chain_A",
"sequence": "MVKVGVNG..."
}
}
],
"modelSeeds": [1, 2, 3]
}

Output Files

The app generates the following output structure:

working_directory/
└── run_YYYYMMDD_HHMMSS/
├── input/
│ ├── [structure files] # Predicted structures
│ ├── [prediction data] # Detailed predictions
│ └── msas/ # Multiple sequence alignments
├── logs/ # Job logs
├── CPU-SLURM/ # CPU phase files
└── GPU-SLURM/ # GPU phase files

Monitoring Jobs

The app provides real-time monitoring of:

  • MSA generation progress
  • Template search status
  • Structure prediction progress
  • Model relaxation status

Troubleshooting

Common issues and solutions:

  1. Job fails in CPU phase:

    • Check available disk space
    • Verify database paths
    • Examine CPU phase logs
  2. GPU phase errors:

    • Verify GPU allocation
    • Check memory requirements
    • Review GPU phase logs
    • For AlphaFold 3: Ensure GPU compute availability.

Contributing

For bugs or feature requests, open an issue.

References

License

MIT (see LICENSE file)

Acknowledgements

  • AlphaFold by DeepMind Technologies Limited
  • Singularity container by prehensilecode
  • The research project is generously funded by Cornell University BRC Epigenomics Core Facility (RRID:SCR_021287), Penn State Institute for Computational and Data Sciences (RRID:SCR_025154) , Penn State University Center for Applications of Artificial Intelligence and Machine Learning to Industry Core Facility (AIMI) (RRID:SCR_022867) and supported by a gift to AIMI research from Dell Technologies.
  • Computational support was provided by NSF ACCESS to William KM Lai and Gretta Kellogg through BIO230041

Contact

For questions or issues, please contact:

Which software (e.g. MatLab, Jupyter, Gaussian)?
Last updated
1774984704
Organization / Author
Which of these apply to your App?